PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00143709001
Common NameGSBRNA2T00143709001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 504aa    MW: 56714.8 Da    PI: 6.5156
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00143709001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox314.5e-103373741954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  GSBRNA2T00143709001 337 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 374
                          665559******************************88 PP

2BELL117.85.3e-38199270172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erqelq+kk+kLl++++eVd+rY+qy++q+++++ssFe+vaglg+akpYts+Al++iS hFrcL+da++eq+
  GSBRNA2T00143709001 199 ERQELQSKKNKLLTMVNEVDQRYNQYHHQMEALASSFEMVAGLGAAKPYTSVALNRISSHFRCLRDALKEQV 270
                          79********************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.2E-50138268IPR006563POX domain
PfamPF075262.6E-44144266IPR006563POX domain
PROSITE profilePS5007112.503315378IPR001356Homeobox domain
CDDcd000862.40E-12318379No hitNo description
SMARTSM003896.5E-10318382IPR001356Homeobox domain
SuperFamilySSF466895.56E-18319387IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28321384IPR009057Homeodomain-like
PfamPF059206.2E-18335374IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MAVYYQTSVG MQPLYQEPIY LNEQQQQQQA SSSSAEIISG GGGLEVPNSG SGVQNEMLFI  60
PPTTSAGLNG SVTVSSNDLS FHGGGLSLSL GNQIQYHYQN LPNQLNYNPS LSNENGKSPS  120
SGYINGVGLY NNYRYETTGF VSSVLRSPYL KPTQLLLDEV VSVRKDSNKK TKNNNDKGQD  180
FTNGSSENNT DNEELSSSER QELQSKKNKL LTMVNEVDQR YNQYHHQMEA LASSFEMVAG  240
LGAAKPYTSV ALNRISSHFR CLRDALKEQV QVIRGKLGED KESCEEQGER IPRLRYLDQR  300
LRQQRALHQQ LGMVRPSWRP QRGLPENSVS ILRAWLFEHF LHPYPKESEK IMLAKQTGLS  360
KNQVANWFIN ARVRLWKPMI EEMYKEEFGD SSSELLSNSN QDKDNNKMKE TSQLKHEDSS  420
SSQQQSHGNN NVPYTSDADR STSGDYDSLM NYHQGFGVDD YNRYIGLGNQ QDATSVNLLS  480
IVFLSMFHPC CKHGDHLDQR NGM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A4e-16324382563Homeobox protein Meis2
4xrm_B4e-16324382563Homeobox protein Meis2
4xrs_A3e-16324381158Homeobox protein Meis1
4xrs_B3e-16324381158Homeobox protein Meis1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00143709001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013648751.10.0PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLA0A078D9G60.0A0A078D9G6_BRANA; BnaC06g22380D protein
STRINGBra003753.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]